Web Analysis for Dpswow - dpswow.com
1.67
Rating by CuteStat
dpswow.com is 1 decade 2 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, dpswow.com is SAFE to browse.
PageSpeed Score
84
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 184.105.154.105)
Sridevi Kalika Parameshwari Amman Aalayam
- sridevikalikaparameshwariammanaalayam.com
Not Applicable
$
8.95
Ankit Rakesh Gupta & Associates- Accounting Services,Taxation Services
- caankitgupta.com
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Content-Length: 8077
Content-Type: text/html
Content-Location: http://dpswow.com/Index.htm
Last-Modified: Thu, 27 Feb 2014 05:09:28 GMT
Accept-Ranges: bytes
ETag: "93d73f177a33cf1:223c60"
Server: Microsoft-IIS/6.0
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Sun, 02 Mar 2014 00:06:00 GMT
Content-Length: 8077
Content-Type: text/html
Content-Location: http://dpswow.com/Index.htm
Last-Modified: Thu, 27 Feb 2014 05:09:28 GMT
Accept-Ranges: bytes
ETag: "93d73f177a33cf1:223c60"
Server: Microsoft-IIS/6.0
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Sun, 02 Mar 2014 00:06:00 GMT
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns11.xincache.com | 36.155.149.180 | China | |
ns12.xincache.com | 112.80.181.111 | China |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
dpswow.com | A | 3589 |
IP: 184.105.154.105 |
dpswow.com | NS | 3599 |
Target: ns11.xincache.com |
dpswow.com | NS | 3599 |
Target: ns12.xincache.com |
dpswow.com | SOA | 3599 |
MNAME: ns11.xincache.com RNAME: hostmaster.xincache.com Serial: 2002042718 Refresh: 3600 Retry: 900 Expire: 720000 Minimum TTL: 3600 |
Full WHOIS Lookup
The Data in Paycenter's WHOIS database is provided by Paycenter
for information purposes, and to assist persons in obtaining
information about or related to a domain name registration record.
Paycenter does not guarantee its accuracy. By submitting
a WHOIS query, you agree that you will use this Data only
for lawful purposes and that,
under no circumstances will you use this Data to:
(1) allow, enable, or otherwise support the transmission
of mass unsolicited, commercial advertising or solicitations
via e-mail (spam); or
(2) enable high volume, automated, electronic processes that
apply to Paycenter or its systems.
Paycenter reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by this policy.!!
Domain Name:dpswow.com
Registry Domain ID:1847932496_domain_com-vrsn
Registrar WHOIS Server:whois.paycenter.com.cn
Registrar URL:http://www.xinnet.com
Updated Date:2014-02-24 15:09:46
Creation Date:2014-02-24 15:09:46
Registrar Registration Expiration Date:2015-02-24 15:09:46
Registrar:XINNET TECHNOLOGY CORPORATION
Registrar IANA ID:120
Registrar Abuse Contact Email:supervision@xinnet.com
Registrar Abuse Contact Phone:+86.1087128064
Domain Status:ok
Registry Registrant ID:
Registrant Name:nivtie
Registrant Organization:nivtie
Registrant Street:pudong
Registrant City:shixiaqu
Registrant State/Province:shanghaishi
Registrant Postal Code:020000
Registrant Country:China
Registrant Phone:51732000
Registrant Phone Ext:
Registrant Fax:51732000
Registrant Fax Ext:
Registrant Email:natinn@163.com
Registry Admin ID:
Admin Name:nivtie
Admin Organization:nivtie
Admin Street:pudong
Admin City:shixiaqu
Admin State/Province:shanghaishi
Admin PostalCode:020000
Admin Country:China
Admin Phone:51732000
Admin Phone Ext:
Admin Fax:51732000
Admin Fax Ext:
Admin Email:natinn@163.com
Registry Tech ID:
Tech Name:nivtie
Tech Organization:nivtie
Tech Street:pudong
Tech City:shixiaqu
Tech State/Province:shanghaishi
Tech PostalCode:020000
Tech Country:China
Tech Phone:51732000
Tech Phone Ext:
Tech Fax:51732000
Tech Fax Ext:
Tech Email:natinn@163.com
Name Server:ns11.xincache.com
Name Server:ns12.xincache.com
DNSSEC:unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2009-05-29T20:15:00Z
for information purposes, and to assist persons in obtaining
information about or related to a domain name registration record.
Paycenter does not guarantee its accuracy. By submitting
a WHOIS query, you agree that you will use this Data only
for lawful purposes and that,
under no circumstances will you use this Data to:
(1) allow, enable, or otherwise support the transmission
of mass unsolicited, commercial advertising or solicitations
via e-mail (spam); or
(2) enable high volume, automated, electronic processes that
apply to Paycenter or its systems.
Paycenter reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by this policy.!!
Domain Name:dpswow.com
Registry Domain ID:1847932496_domain_com-vrsn
Registrar WHOIS Server:whois.paycenter.com.cn
Registrar URL:http://www.xinnet.com
Updated Date:2014-02-24 15:09:46
Creation Date:2014-02-24 15:09:46
Registrar Registration Expiration Date:2015-02-24 15:09:46
Registrar:XINNET TECHNOLOGY CORPORATION
Registrar IANA ID:120
Registrar Abuse Contact Email:supervision@xinnet.com
Registrar Abuse Contact Phone:+86.1087128064
Domain Status:ok
Registry Registrant ID:
Registrant Name:nivtie
Registrant Organization:nivtie
Registrant Street:pudong
Registrant City:shixiaqu
Registrant State/Province:shanghaishi
Registrant Postal Code:020000
Registrant Country:China
Registrant Phone:51732000
Registrant Phone Ext:
Registrant Fax:51732000
Registrant Fax Ext:
Registrant Email:natinn@163.com
Registry Admin ID:
Admin Name:nivtie
Admin Organization:nivtie
Admin Street:pudong
Admin City:shixiaqu
Admin State/Province:shanghaishi
Admin PostalCode:020000
Admin Country:China
Admin Phone:51732000
Admin Phone Ext:
Admin Fax:51732000
Admin Fax Ext:
Admin Email:natinn@163.com
Registry Tech ID:
Tech Name:nivtie
Tech Organization:nivtie
Tech Street:pudong
Tech City:shixiaqu
Tech State/Province:shanghaishi
Tech PostalCode:020000
Tech Country:China
Tech Phone:51732000
Tech Phone Ext:
Tech Fax:51732000
Tech Fax Ext:
Tech Email:natinn@163.com
Name Server:ns11.xincache.com
Name Server:ns12.xincache.com
DNSSEC:unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2009-05-29T20:15:00Z