1.67 Rating by CuteStat

dpswow.com is 1 decade 2 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, dpswow.com is SAFE to browse.

PageSpeed Score
84
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

184.105.154.105

Hosted Country:

United States of America US

Location Latitude:

37.3394

Location Longitude:

-121.895
UltimateDPS for WoW

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 184.105.154.105)

Dudejaarts

- dudejaarts.com

digital printing

Not Applicable $ 8.95

Domain Default page

- superhometips.com
Not Applicable $ 8.95

Sridevi Kalika Parameshwari Amman Aalayam

- sridevikalikaparameshwariammanaalayam.com
Not Applicable $ 8.95


Supra eDesigns

- webedesign.in
860,687 $ 720.00

HTTP Header Analysis

HTTP/1.1 200 OK
Content-Length: 8077
Content-Type: text/html
Content-Location: http://dpswow.com/Index.htm
Last-Modified: Thu, 27 Feb 2014 05:09:28 GMT
Accept-Ranges: bytes
ETag: "93d73f177a33cf1:223c60"
Server: Microsoft-IIS/6.0
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Sun, 02 Mar 2014 00:06:00 GMT

Domain Information

Domain Registrar: Nimzo 18, LLC
Registration Date: Feb 24, 2014, 12:00 AM 1 decade 2 months 2 weeks ago
Last Modified: Feb 24, 2014, 12:00 AM 1 decade 2 months 2 weeks ago
Expiration Date: Feb 24, 2015, 12:00 AM 9 years 2 months 2 weeks ago
Domain Status:
ok

Domain Nameserver Information

Host IP Address Country
ns11.xincache.com 36.155.149.180 China China
ns12.xincache.com 112.80.181.111 China China

DNS Record Analysis

Host Type TTL Extra
dpswow.com A 3589 IP: 184.105.154.105
dpswow.com NS 3599 Target: ns11.xincache.com
dpswow.com NS 3599 Target: ns12.xincache.com
dpswow.com SOA 3599 MNAME: ns11.xincache.com
RNAME: hostmaster.xincache.com
Serial: 2002042718
Refresh: 3600
Retry: 900
Expire: 720000
Minimum TTL: 3600

Full WHOIS Lookup

The Data in Paycenter's WHOIS database is provided by Paycenter
for information purposes, and to assist persons in obtaining
information about or related to a domain name registration record.
Paycenter does not guarantee its accuracy. By submitting
a WHOIS query, you agree that you will use this Data only
for lawful purposes and that,
under no circumstances will you use this Data to:
(1) allow, enable, or otherwise support the transmission
of mass unsolicited, commercial advertising or solicitations
via e-mail (spam); or
(2) enable high volume, automated, electronic processes that
apply to Paycenter or its systems.
Paycenter reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by this policy.!!

Domain Name:dpswow.com
Registry Domain ID:1847932496_domain_com-vrsn
Registrar WHOIS Server:whois.paycenter.com.cn
Registrar URL:http://www.xinnet.com
Updated Date:2014-02-24 15:09:46
Creation Date:2014-02-24 15:09:46
Registrar Registration Expiration Date:2015-02-24 15:09:46
Registrar:XINNET TECHNOLOGY CORPORATION
Registrar IANA ID:120
Registrar Abuse Contact Email:supervision@xinnet.com
Registrar Abuse Contact Phone:+86.1087128064
Domain Status:ok
Registry Registrant ID:
Registrant Name:nivtie
Registrant Organization:nivtie
Registrant Street:pudong
Registrant City:shixiaqu
Registrant State/Province:shanghaishi
Registrant Postal Code:020000
Registrant Country:China
Registrant Phone:51732000
Registrant Phone Ext:
Registrant Fax:51732000
Registrant Fax Ext:
Registrant Email:natinn@163.com
Registry Admin ID:
Admin Name:nivtie
Admin Organization:nivtie
Admin Street:pudong
Admin City:shixiaqu
Admin State/Province:shanghaishi
Admin PostalCode:020000
Admin Country:China
Admin Phone:51732000
Admin Phone Ext:
Admin Fax:51732000
Admin Fax Ext:
Admin Email:natinn@163.com
Registry Tech ID:
Tech Name:nivtie
Tech Organization:nivtie
Tech Street:pudong
Tech City:shixiaqu
Tech State/Province:shanghaishi
Tech PostalCode:020000
Tech Country:China
Tech Phone:51732000
Tech Phone Ext:
Tech Fax:51732000
Tech Fax Ext:
Tech Email:natinn@163.com
Name Server:ns11.xincache.com
Name Server:ns12.xincache.com
DNSSEC:unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2009-05-29T20:15:00Z